Recombinant Human S-arrestin(SAG)

Recombinant Human S-arrestin(SAG)
Size
500 μg
Catalog no.
RPC20290
Price
831 EUR
Buy

Gene number

SAG

Protein origin

Yeast

Use before

1 year

Protein number

P10523

Protein purity

≥ 90%

Protein region

1-405aa

Shipping requirements

Blue ice

Expected molecular weight

47.12kDa

Information about sequence

Full Length

Group

recombinants

Estimated production time

7-11 business days

Verified reactivity

Homo sapiens (Human)

Source

Recombinants or rec. proteins

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Other name

48 kDa protein; Retinal S-antigen; Short name:; S-AG; Rod photoreceptor arrestin

Protein sequence

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.