Rabbit Arrestin B2 antibody
- Size
- 50 ug
- Catalog no.
- 70R-2559
- Price
- 495 EUR
Buy
French translation
anticorps
Cross Reactivity
Human,Dog
Product Type
Primary Antibodies
Research Area
Signal Transduction
Latin name
Oryctolagus cuniculus
Product Subtype
Purified Polyclonal Antibodies
Specificity
Arrestin B2 antibody was raised against the middle region of ARRB2
Form & Buffer
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARRB2 antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Immunogen
Arrestin B2 antibody was raised using the middle region of ARRB2 corresponding to a region with amino acids RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
About
Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
