- Size
- 100 ug
- Catalog no.
- 33R-2303
- Price
- 280 EUR
Buy
Properties
blocking peptide
Product Subtype
Blocking Peptides
Research Area
Signal Transduction
Tag/Conjugate
EDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS
Storage
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Test
You can block the antibody by the specific target amino acid sequence of peptide.
Form & Buffer
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Description
Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
