- Size
- 50 µg
- Catalog no.
- 70R-2559
- Price
- 475 EUR
Buy
Shipping conditions
Blue Ice
French translation
anticorps
Cross Reactivity
Human,Dog
Category
Primary Antibody
Method of Purification
Affinity purified
Area of research
Signal Transduction
Usage Recommendations
WB: 1 ug/ml; IHC: 4-8 ug/ml
Antibody Subtype
Polyclonal Antibodies, Purified
Specificity
Arrestin B2 antibody was raised against the middle region of ARRB2
Form & Buffer
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARRB2 antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Type of Immunogen
Arrestin B2 antibodies were raised using the middle region of ARRB2 corresponding to a region with amino acids RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
Assay Information
Arrestin B2 Blocking Peptide, catalog no. 33R-8056, is also available for use as a blocking control in assays to test for specificity of this Arrestin B2 antibody
Additional Information
This is a rabbit polyclonal antibody against ARRB2. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
