Recombinant Human S-arrestin(SAG)
- Size
- 100 μg
- Catalog no.
- RPC20290
- Price
- 660 EUR
Buy
Shipping requirements
Blue ice
Expected molecular weight
47.12kDa
Information about sequence
Full Length
Estimated production time
7-11 business days
Verified reactivity
Homo sapiens (Human)
Source
Recombinants or rec. proteins
Notes
For research use only. Not for diagnostic procedures.
Storage recommendation
Aliquot and store at -20°C. Minimize freezing and thawing.
Other name
48 kDa protein; Retinal S-antigen; Short name:; S-AG; Rod photoreceptor arrestin
Protein sequence
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
